Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-AARSD1 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-IEFYAKVNSKDSQDK, from the internal region of the protein sequence according to NP_001129514.2; NP_079543.1; NP_001136125.1; NP_001136126.1. |
Rabbit Polyclonal Anti-PTGES3L-AARSD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PTGES3L-AARSD1 antibody is: synthetic peptide directed towards the N-terminal region of Human PTGES3L-AARSD1. Synthetic peptide located within the following region: ELYNEIEFYAKVNSKDSQDKRSSRSITCFVRKWKEKVAWPRLTKEDIKPV |
Rabbit Polyclonal Anti-PTGES3L-AARSD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PTGES3L-AARSD1 antibody is: synthetic peptide directed towards the C-terminal region of Human PTGES3L-AARSD1. Synthetic peptide located within the following region: LLFLTVGDEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKA |
Active filters
Target Symbol
- AARSD1