Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ATP2C1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 400-660 of human ATP2C1 (NP_001186114.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-ATP2C1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP2C1 antibody: synthetic peptide directed towards the C terminal of human ATP2C1. Synthetic peptide located within the following region: TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA |
ATP2C1 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from an internal domain of human ATPase2C1 |
Active filters
Target Symbol
- ATP2C1