Antibodies

View as table Download

ASTE1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ASTE1

ASTE1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ASTE1

Rabbit Polyclonal Anti-Aste1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Aste1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Aste1. Synthetic peptide located within the following region: TKSYAPAELFLPKTKSKSKKKRQKKKVASLGTTADAKHWYDRSNRFGPLM

Aste1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of mouse ASTE1

Aste1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse