Antibodies

View as table Download

Rabbit Polyclonal Anti-ASF1A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ASF1A

Goat Polyclonal Antibody against ASF1A

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-ENSLNVMLESH, from the C Terminus of the protein sequence according to NP_054753.1.

Goat Polyclonal Antibody against ASF1A / HSPC146

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EDNTEKLEDAE, from the internal region of the protein sequence according to NP_054753.1.

Rabbit polyclonal anti-ASF1A antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ASF1A.

Rabbit Polyclonal Anti-ASF1A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASF1A antibody: synthetic peptide directed towards the N terminal of human ASF1A. Synthetic peptide located within the following region: MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES

Rabbit Polyclonal Anti-ASF1A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ASF1A Antibody: A synthesized peptide derived from human ASF1A

ASF1A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human ASF1A

ASF1A rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ASF1A

ASF1A rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ASF1A

Asf1a (H150) polyclonal antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 120-180 of Human Asf1a.