Rabbit Polyclonal Anti-ASB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ASB3 |
Rabbit Polyclonal Anti-ASB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ASB3 |
GPR75-ASB3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 14-42 amino acids from the N-terminal region of human ASB3 |
Rabbit Polyclonal Anti-ASB3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ASB3 antibody: synthetic peptide directed towards the middle region of human ASB3. Synthetic peptide located within the following region: LEIRSSLKSERLRSDSYISQLPLPRSLHNYLLYEDVLRMYEVPELAAIQD |