Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ART5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ART5 antibody is: synthetic peptide directed towards the N-terminal region of Human ART5. Synthetic peptide located within the following region: HALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWEL |
Rabbit polyclonal anti-ART5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ART5 antibody: synthetic peptide directed towards the middle region of human ART5. Synthetic peptide located within the following region: VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE |
Active filters
Target Symbol
- ART5