Antibodies

View as table Download

Rabbit Polyclonal Anti-SHROOM2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SHROOM2

Rabbit Polyclonal Anti-SHROOM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHROOM2 antibody: synthetic peptide directed towards the middle region of human SHROOM2. Synthetic peptide located within the following region: CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM