Rabbit Polyclonal Anti-APOBEC3D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human APOBEC3D |
Rabbit Polyclonal Anti-APOBEC3D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human APOBEC3D |
Rabbit polyclonal APOBEC3D/F antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APOBEC3D/F. |
Rabbit Polyclonal Anti-APOBEC3D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APOBEC3D antibody: synthetic peptide directed towards the N terminal of human APOBEC3D. Synthetic peptide located within the following region: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE |
Goat Anti-APOBEC3D (aa61-74) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PKRQSNHRQEVYFR, from the internal region of the protein sequence according to NP_689639.2. |
APOBEC3D Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human APOBEC3D |
APOBEC3D Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 207-386 of human APOBEC3D (NP_689639.2). |
Modifications | Unmodified |