Antibodies

Jump to Filters
View as table Download
Ap1s1 Rabbit Polyclonal Antibody
TA331243

USD 539.00

5 Days

Rabbit Polyclonal Anti-Ap1s1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ap1s1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ap1s1. Synthetic peptide located within the following region: VCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES
AP1S1 Rabbit Polyclonal Antibody
TA365938

USD 380.00

4 Weeks

AP1S1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human AP1S1