Alpha 1 microglobulin (AMBP) sheep polyclonal antibody, Purified
| Applications | ELISA, ID |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Highly pure human alpha-1-microglobulin, prepared from the urine of patients with chronic renal proteinuria (Molecular Weight 25-30 kD). |
Rabbit Polyclonal Anti-Ambp Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ambp antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: ATLESYVVHTNYDEYAIFLTKKFSHRHGPTITAKLYGREPQLRDSLLQEF |
Ambp Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ambp |
Germany
Japan
United Kingdom
China