Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ALDH5A1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human ALDH5A1. |
ALDH5A1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human ALDH5A1. |
Rabbit Polyclonal Aldh5A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aldh5A1 antibody was raised against a 22 amino acid peptide near the carboxy terminus of the human Aldh5A1. |
Goat Anti-ALDH5A1 (aa 301-312) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TGKILLHHAANS, from the internal region of the protein sequence according to NP_733936.1; NP_001071.1. |
Rabbit Polyclonal Anti-ALDH5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH5A1 antibody: synthetic peptide directed towards the middle region of human ALDH5A1. Synthetic peptide located within the following region: AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM |
Goat Anti-ALDH5A1 (aa 485-496), Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Peptide with sequence C-SQDPAQIWRVAE., from the internal region of the protein sequence according to NP_733936.1; NP_001071.1. |
ALDH5A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human ALDH5A1 (NP_001071.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ALDH5A1