Rabbit Polyclonal Anti-Ahrr Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ahrr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CLRGGPDLLDPKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPV |
Rabbit Polyclonal Anti-AHRR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AHRR antibody: synthetic peptide directed towards the middle region of human AHRR. Synthetic peptide located within the following region: LPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVP |
Germany
Japan
United Kingdom
China