Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Rabbit polyclonal anti-AHSA1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AHSA1. |
AHA1 (AHSA1) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human AHSA1 |
Rabbit polyclonal anti-AHA1 antibody
| Applications | WB |
| Reactivities | Human, Chimpanzee |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human AHA1 protein. |
Rabbit Polyclonal Anti-Aha1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Mouse Aha1 |
Rabbit Polyclonal Anti-AHSA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AHSA1 antibody is: synthetic peptide directed towards the C-terminal region of Human AHSA1. Synthetic peptide located within the following region: VMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQ |
Rabbit Polyclonal Anti-AHSA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AHSA1 antibody is: synthetic peptide directed towards the C-terminal region of Human AHSA1. Synthetic peptide located within the following region: NGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTS |
Active filters
Target Symbol
- AHA1