Antibodies

View as table Download

ADAM12 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 589-738 of human ADAM12 (NP_067673.2).
Modifications Unmodified

ADAM12 (N-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence AARPLPVSPARALC from the N-Terminal region of ADAM-12

Anti-ADAM12 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 223-239 amino acids of human ADAM metallopeptidase domain 12

ADAM12 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADAM12

Goat Polyclonal Antibody against ADAM12

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence AARPLPVSPARALC, from the N Terminus of the protein sequence according to NP_003465; NP_067673.

Goat Anti-ADAM12 (aa225-239) Antibody

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-REFQRQGKDLEKVKQ, from the internal region of the protein sequence according to NP_003465.3; NP_067673.2.

Rabbit Polyclonal Anti-ADAM12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAM12 antibody: synthetic peptide directed towards the N terminal of human ADAM12. Synthetic peptide located within the following region: VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE