Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against ARP1 homolog A
| Applications | FC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YEEDGARSIHRKT, from the C Terminus of the protein sequence according to NP_005727.1. |
Anti-ACTR1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) |
ACTR1A (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 97-126 amino acids from the Central region of human ACTR1A |
Rabbit Polyclonal Anti-ACTR1A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTR1A antibody: synthetic peptide directed towards the middle region of human ACTR1A. Synthetic peptide located within the following region: AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP |
ACTR1A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ACTR1A |
ACTR1A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 187-376 of human ACTR1A (NP_005727.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ACTR1A