ACSF2 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ACSF2 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACSF2 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
ACSF2 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
ACSF2 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ACSF2 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ACSF2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACSF2 |
ACSF2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACSF2 |
Rabbit Polyclonal Anti-ACSF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACSF2 antibody: synthetic peptide directed towards the C terminal of human ACSF2. Synthetic peptide located within the following region: DLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTL |