Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal TMPRSS3 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TMPRSS3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 272-300 amino acids from the Central region of human TMPRSS3. |
Rabbit Polyclonal Anti-TMPRSS3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS3 antibody: synthetic peptide directed towards the N terminal of human TMPRSS3. Synthetic peptide located within the following region: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP |
Goat Polyclonal Antibody against TMPRSS3
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKIVYHSKYKPKR, from the internal region of the protein sequence according to NP_076927.1; NP_115777.1; NP_115780.1; NP_115781.1. |
Rabbit Polyclonal Anti-Tmprss3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tmprss3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tmprss3. Synthetic peptide located within the following region: ISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVN |
Rabbit Polyclonal Anti-TMPRSS3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS3 antibody: synthetic peptide directed towards the N terminal of human TMPRSS3. Synthetic peptide located within the following region: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- TMPRSS3