Rabbit Polyclonal Anti-RASSF7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RASSF7 Antibody: synthetic peptide directed towards the middle region of human RASSF7. Synthetic peptide located within the following region: RVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAATAEHAARLQAL |
Goat Polyclonal Antibody against RASSF7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CTDLRGLELRVQRN, from the internal region of the protein sequence according to NP_003466.1. |
Rabbit Polyclonal Anti-RASSF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RASSF7 Antibody: synthetic peptide directed towards the middle region of human RASSF7. Synthetic peptide located within the following region: QSAEVQGSLALVSRALEAAERALQAQAQELEELNRELRQCNLQQFIQQTG |
Rabbit Polyclonal Anti-RASSF7 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RASSF7 antibody: synthetic peptide directed towards the middle region of human RASSF7. Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY |
Germany
Japan
United Kingdom
China
