Rabbit polyclonal MORC3 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MORC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 634-663 amino acids from the Central region of human MORC3. |
Morc3 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Morc3 whole rabbit serum was prepared by repeated immunizations with a mouse Morc3 recombinant protein. |
Morc3 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Morc3 whole rabbit serum was prepared by repeated immunizations with a mouse Morc3 recombinant protein. |
Morc3 Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Morc3 whole rabbit serum was prepared by repeated immunizations with a human Morc3 recombinant protein. |
Rabbit Polyclonal Anti-MORC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MORC3 antibody: synthetic peptide directed towards the N terminal of human MORC3. Synthetic peptide located within the following region: KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT |
Germany
Japan
United Kingdom
China
