Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to KHS (mitogen-activated protein kinase kinase kinase kinase 5)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 417 and 482 of KHS |
Rabbit Polyclonal Anti-MAP4K5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAP4K5 Antibody is: synthetic peptide directed towards the C-terminal region of Human MAP4K5. Synthetic peptide located within the following region: KSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILAGHENS |
Rabbit Polyclonal Anti-MAP4K5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAP4K5 Antibody: synthetic peptide directed towards the middle region of human MAP4K5. Synthetic peptide located within the following region: QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA |
MAP4K5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-480 of human MAP4K5 (NP_006566.2). |
| Modifications | Unmodified |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- MAP4K5