Rabbit Polyclonal Anti-MAGEE1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAGEE1 |
Rabbit Polyclonal Anti-MAGEE1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAGEE1 |
Rabbit Polyclonal Anti-MAGEC2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAGEC2 |
MAGEE1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAGEE1 |
Rabbit polyclonal anti-MAGEC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAGEC2. |
Rabbit Polyclonal Anti-MAGEC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAGEC2 antibody: synthetic peptide directed towards the N terminal of human MAGEC2. Synthetic peptide located within the following region: SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF |