Antibodies

View as table Download

IL21 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98%) E.coli derived recombinant human IL-21.

IL21 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (> 98%) E.coli derived recombinant Human IL-21

Rabbit Polyclonal IL-21 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor .

IL-21 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen IL21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor .

IL21 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98%) E.coli derived recombinant human IL-21.

IL21 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine
Conjugation Unconjugated
Immunogen Recombinant protein raised in yeast, corresponding to amino acid residues 24-152 of bovine IL-21 protein

IL21 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine
Conjugation Unconjugated
Immunogen Recombinant protein raised in yeast, corresponding to amino acid residues 24-152 of bovine IL-21 protein

Rabbit Polyclonal Anti-IL21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL21 antibody is: synthetic peptide directed towards the C-terminal region of Human IL21. Synthetic peptide located within the following region: ERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKS

Rabbit polyclonal anti-IL21 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IL21.

IL21 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-162 of human IL21 (NP_068575.1).
Modifications Unmodified

IL21 mouse monoclonal antibody, clone B-P41, Azide Free

Applications ELISA
Reactivities Human
Conjugation Unconjugated

IL21 mouse monoclonal antibody, clone B-Z16, Azide Free

Applications ELISA
Reactivities Human
Conjugation Unconjugated