Rabbit Polyclonal Anti-HSD17B14 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B14 |
Rabbit Polyclonal Anti-HSD17B14 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B14 |
HSD17B14 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B14 |
Rabbit Polyclonal Anti-HSD17B14 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD17B14 antibody: synthetic peptide directed towards the middle region of human HSD17B14. Synthetic peptide located within the following region: QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP |
Rabbit Polyclonal Anti-HSD17B14 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD17B14 antibody: synthetic peptide directed towards the N terminal of human HSD17B14. Synthetic peptide located within the following region: RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD |