Antibodies

View as table Download

Rabbit Polyclonal Anti-HCLS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP

Rabbit Polyclonal Anti-HCLS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP

Rabbit polyclonal HS1 (Ab-397) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HCLS1.

Rabbit Polyclonal Anti-Phospho-HS1(Tyr378) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-HS1(Tyr378) Antibody: A synthesized peptide derived from human HS1 around the phosphorylation site of Tyrosine 378
Modifications Phospho-specific

HCLS1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HCLS1

Rabbit Polyclonal Anti-HCLS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: FGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAV

HCLS1 pTyr397 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 397(G-D-Y(p)-E-E) derived from Human HS1 (KLH-conjugated)

HCLS1 pTyr397 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 397(G-D-Y(p)-E-E) derived from Human HS1 (KLH-conjugated)

Rabbit anti-HCLS1 polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit polyclonal HS1 (Tyr397) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human HS1 around the phosphorylation site of tyrosine 397 (G-D-YP-E-E).
Modifications Phospho-specific