GSG1 mouse monoclonal antibody,clone OTI3E7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GSG1 mouse monoclonal antibody,clone OTI3E7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GSG1 mouse monoclonal antibody,clone OTI1H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GSG1 mouse monoclonal antibody,clone OTI4A9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSG1 mouse monoclonal antibody,clone OTI3E7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSG1 mouse monoclonal antibody,clone OTI1H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSG1 mouse monoclonal antibody,clone OTI4A9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GSG1 mouse monoclonal antibody,clone OTI3E7, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GSG1 mouse monoclonal antibody,clone OTI3E7, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GSG1 mouse monoclonal antibody,clone OTI1H9, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GSG1 mouse monoclonal antibody,clone OTI1H9, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GSG1 mouse monoclonal antibody,clone OTI4A9, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GSG1 mouse monoclonal antibody,clone OTI4A9, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-GSG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSG1 Antibody: synthetic peptide directed towards the C terminal of human GSG1. Synthetic peptide located within the following region: VLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQP |
Rabbit Polyclonal Anti-GSG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSG1 Antibody: synthetic peptide directed towards the C terminal of human GSG1. Synthetic peptide located within the following region: VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE |
Rabbit Polyclonal Anti-GSG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSG1 Antibody: synthetic peptide directed towards the N terminal of human GSG1. Synthetic peptide located within the following region: NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD |