Rabbit Polyclonal BANF1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | BANF1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human BANF1. |
Rabbit Polyclonal BANF1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | BANF1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human BANF1. |
Rabbit Polyclonal BANF1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BANF1 antibody was raised against a 19 amino acid peptide from near the amino terminus of human BANF1. |
Rabbit Polyclonal Anti-BANF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BANF1 antibody is: synthetic peptide directed towards the middle region of Human BANF1. Synthetic peptide located within the following region: FDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAF |
BANF1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-89 of human BANF1 (NP_001137457.1). |
Modifications | Unmodified |