Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USP2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Gorilla, Human, Monkey, Mouse, Rabbit, Rat, Gibbon, Hamster, Horse (Predicted: Pig) |
| Conjugation | Unconjugated |
| Immunogen | USP2 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human USP2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum (100%); Pig (94%). |
USP2 (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human USP2. |
USP2 (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human USP2. |
Rabbit Polyclonal Anti-USP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP2 antibody: synthetic peptide directed towards the middle region of human USP2. Synthetic peptide located within the following region: NEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK |
Rabbit Polyclonal Anti-USP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP2 antibody: synthetic peptide directed towards the N terminal of human USP2. Synthetic peptide located within the following region: LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN |
USP2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USP2 |
USP2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USP2 |
Active filters
Target Symbol
- USP2