Anti-TPBG Reference Antibody (PF-06263507)
Applications | Animal Model, ELISA, FACS, FN, Kinetics |
Reactivities | Human, Cynomolgus |
Conjugation | Unconjugated |
Anti-TPBG Reference Antibody (PF-06263507)
Applications | Animal Model, ELISA, FACS, FN, Kinetics |
Reactivities | Human, Cynomolgus |
Conjugation | Unconjugated |
Anti-TPBG Reference Antibody (naptumomAb)
Applications | Animal Model, ELISA, FACS, FN, Kinetics |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TPBG Reference Antibody (ASN004)
Applications | Animal Model, ELISA, FACS, FN, Kinetics |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TPBG Reference Antibody (Wyeth patent anti-5T4)
Applications | Animal Model, ELISA, FACS, FN, Kinetics |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Tpbg Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Tpbg antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tpbg. Synthetic peptide located within the following region: GDGRLRLARLALVLLGWVSASAPSSSVPSSSTSPAAFLASGSAQPPPAER |
5T4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 32-350 of human 5T4 (NP_006661.1). |
Modifications | Unmodified |