Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-LBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LBP antibody: synthetic peptide directed towards the middle region of human LBP. Synthetic peptide located within the following region: LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV |
Lbp rat monoclonal antibody, clone M330-19, Liquid
| Applications | ELISA, FN, Neutralize, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LBP antibody: synthetic peptide directed towards the C terminal of human LBP. Synthetic peptide located within the following region: FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL |
LBP Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse LBP |
LBP mouse monoclonal antibody, clone 1C7, Purified
| Applications | ELISA, FN, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
LBP mouse monoclonal antibody, clone 6G3, Purified
| Applications | ELISA, FN, IP |
| Reactivities | Bovine, Canine, Goat, Human, Monkey, Porcine, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
Lbp rat monoclonal antibody, clone RR433-8, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Lbp rat monoclonal antibody, clone M330-19, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
LBP rabbit polyclonal antibody, Purified
| Applications | ELISA, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- LBP