PHOSPHO2 (Myc-DDK tagged) - Homo sapiens PHOSPHO2-KLHL23 readthrough (PHOSPHO2-KLHL23)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (Myc-DDK tagged) - Homo sapiens PHOSPHO2-KLHL23 readthrough (PHOSPHO2-KLHL23)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PHOSPHO2 (tGFP-tagged) - Homo sapiens PHOSPHO2-KLHL23 readthrough (PHOSPHO2-KLHL23)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-KLHL23 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLHL23 antibody: synthetic peptide directed towards the middle region of human KLHL23. Synthetic peptide located within the following region: TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY |
AAV ORF Particles, serotype AAV-2, PHOSPHO2 (Myc-DDK tagged) - Homo sapiens PHOSPHO2-KLHL23 readthrough (PHOSPHO2-KLHL23), 250ul, >10^13 GC/mL
PHOSPHO2 (untagged) - Homo sapiens PHOSPHO2-KLHL23 readthrough (PHOSPHO2-KLHL23)
Vector | pCMV6-Entry |
Tag | Tag Free |