Antibodies

View as table Download

PHOSPHO2 (Myc-DDK tagged) - Homo sapiens PHOSPHO2-KLHL23 readthrough (PHOSPHO2-KLHL23)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PHOSPHO2 (tGFP-tagged) - Homo sapiens PHOSPHO2-KLHL23 readthrough (PHOSPHO2-KLHL23)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-KLHL23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL23 antibody: synthetic peptide directed towards the middle region of human KLHL23. Synthetic peptide located within the following region: TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY

AAV ORF Particles, serotype AAV-2, PHOSPHO2 (Myc-DDK tagged) - Homo sapiens PHOSPHO2-KLHL23 readthrough (PHOSPHO2-KLHL23), 250ul, >10^13 GC/mL

  • AAV ORF®