Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against Factor Inhibiting HIF-1
| Applications | Electron Microscopy, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A C-terminal region synthetic peptide made to the human FIH protein sequence (between residues 300 and the C-terminus). |
HIF1AN (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human HIF1AN. |
HIF1AN (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human HIF1AN. |
Rabbit Polyclonal Anti-HIF1AN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HIF1AN Antibody: synthetic peptide directed towards the N terminal of human HIF1AN. Synthetic peptide located within the following region: EAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTN |
Rabbit Polyclonal Anti-HIF1AN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HIF1AN Antibody: synthetic peptide directed towards the middle region of human HIF1AN. Synthetic peptide located within the following region: TSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPV |
Rabbit Polyclonal Anti-HIF1AN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the N terminal of human HIF1AN. Synthetic peptide located within the following region: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDP |
Rabbit Polyclonal Anti-HIF1AN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the middle region of human HIF1AN. Synthetic peptide located within the following region: GGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEV |
Active filters
Target Symbol
- HIF1AN