CD162 (SELPLG) rat monoclonal antibody, clone HECA-452, Aff - Purified
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CD162 (SELPLG) rat monoclonal antibody, clone HECA-452, Aff - Purified
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SELPLG Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SELPLG |
CD162 (SELPLG) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 386-413 amino acids from the C-terminal region of Human SELPLG |
CD162 (SELPLG) mouse monoclonal antibody, clone TC2, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD162 (SELPLG) mouse monoclonal antibody, clone TC2, APC
Applications | FC |
Reactivities | Human |
Conjugation | APC |
CD162 (SELPLG) mouse monoclonal antibody, clone TC2, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD162 (SELPLG) mouse monoclonal antibody, clone TC2, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
SELPLG Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SELPLG |
Rabbit Polyclonal Anti-SELPLG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the C-terminal region of Human SELPLG. Synthetic peptide located within the following region: EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF |
Rabbit Polyclonal Anti-SELPLG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the N-terminal region of Human SELPLG. Synthetic peptide located within the following region: GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR |
Anti-CD162 antibody(DMC283), IgG1 Chimeric mAb
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |