Antibodies

Jump to Filters
View as table Download
C16orf13 (METTL26) (N-term) Rabbit Polyclonal Antibody
AP51041PU-N

USD 580.00

2 Weeks

C16orf13 (METTL26) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Hamster, Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human CP013.
C16orf13 (METTL26) Rabbit Polyclonal Antibody
TA333614

USD 539.00

5 Days

Rabbit Polyclonal Anti-C16orf13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C16orf13 Antibody is: synthetic peptide directed towards the N-terminal region of Human C16orf13. Synthetic peptide located within the following region: PLAEWQPSDVDQRCLDSIAATTQAQGLTNVKAPLHLDVTWGWEHWGGILP