Antibodies

Jump to Filters
View as table Download
Stanniocalcin 1 (STC1) Rabbit Polyclonal Antibody
TA382108

USD 365.00

3 Weeks

STC1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-247 of human STC1 (NP_003146.1).
Modifications Unmodified
Stc1 Rabbit Polyclonal Antibody
TA346345

USD 539.00

5 Days

Rabbit Polyclonal Anti-Stc1 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Stc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Stc1. Synthetic peptide located within the following region: EKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEG
Stanniocalcin 1 (STC1) Rabbit Polyclonal Antibody
TA382107

USD 365.00

3 Weeks

STC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-247 of human STC1 (NP_003146.1).