Antibodies

View as table Download

Rabbit Polyclonal Anti-ARF1 Antibody

Applications IHC, IP, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

Anti-ARF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 100-115 amino acids of Human ADP-ribosylation factor 1

ARF1 Rabbit polyclonal Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human ARF1

Goat Polyclonal Antibody against ARF1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EGLDWLSNQLRNQK, from the C Terminus of the protein sequence according to NP_001019397.1; NP_001649.1; NP_001019398.1; NP_001019399.1.

ARF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ARF1
Modifications Unmodified