Antibodies

Jump to Filters
View as table Download
Yod1 Rabbit Polyclonal Antibody
TA331556

USD 539.00

5 Days

Rabbit Polyclonal Anti-Yod1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Yod1 Antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Yod1. Synthetic peptide located within the following region: VPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSSRTRLRELQGQ
YOD1 Rabbit Polyclonal Antibody
TA383413

USD 365.00

3 Weeks

YOD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-348 of human YOD1 (NP_061036.3).
Modifications Unmodified