Rabbit Polyclonal Anti-UCHL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-UCHL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
UCHL3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-UCHL3 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Uchl3 antibody is: synthetic peptide directed towards the middle region of Mouse Uchl3. Synthetic peptide located within the following region: IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET |
UCHL3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human UCHL3 (NP_005993.1). |
Modifications | Unmodified |