FOXP4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXP4 |
FOXP4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXP4 |
FOXP4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXP4 |
Rabbit Polyclonal Anti-FOXP4 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXP4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QEDLGVPGEPLPSNGSSSPPRLSPPQYSHQIQVKEEPAEAEEDRRPGPPL |
Rabbit Polyclonal Anti-FOXP4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FOXP4 (N-term) goat polyclonal antibody, Aff - Purified
Applications | PEP-ELISA |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide from the N Terminus of the protein sequence according to NP_612466. |