Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 9 of 9 results

(reset)

BCAT1 Mouse Monoclonal Antibody [Clone ID: OTI3F5]

TA504360

USD 478.00

In Stock

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications	IHC, WB
Reactivities	Human, Dog, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

BCAT1 Mouse Monoclonal Antibody [Clone ID: OTI3F5]

CF504360

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications	IHC, WB
Reactivities	Human, Dog, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

BCAT1 Mouse Monoclonal Antibody [Clone ID: OTI3F5]

TA504360S

USD 200.00

2 Days

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications	IHC, WB
Reactivities	Human, Dog, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

BCAT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F5]

TA504360AM

USD 509.00

2 Weeks

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), Biotinylated

Applications	IHC, WB
Reactivities	Human, Dog, Mouse
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

BCAT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F5]

TA504360BM

USD 509.00

2 Weeks

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Dog, Mouse
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

BCAT1 Rabbit Polyclonal Antibody

TA364681

USD 380.00

4 Weeks

BCAT1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human BCAT1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TA364681 is a possible alternative to TA349704.

BCAT1 Rabbit Polyclonal Antibody

TA349704

USD 380.00

In Stock

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human BCAT1

1 / 3

2 / 3

3 / 3

Previous Next

Bcat1 Rabbit Polyclonal Antibody

TA339286

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-Bcat1 Antibody

Applications	WB
Reactivities	Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-Bcat1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTI

BCAT1 Rabbit Polyclonal Antibody

TA373958

USD 365.00

3 Weeks

BCAT1 Rabbit polyclonal Antibody

Applications	ICC/IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide of human BCAT1
Modifications	Unmodified

1 - 9 of 9 results