Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-USP8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP8 antibody: synthetic peptide directed towards the C terminal of human USP8. Synthetic peptide located within the following region: FAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA |
USP8 (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human USP8. |
Rabbit Polyclonal Anti-USP8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP8 antibody: synthetic peptide directed towards the N terminal of human USP8. Synthetic peptide located within the following region: KGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLI |
USP8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human USP8 |
Active filters
Target Symbol
- USP8
Reactivities
- Human