TCF19 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TCF19 |
TCF19 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TCF19 |
Rabbit Polyclonal Anti-TCF19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCF19 Antibody: synthetic peptide directed towards the N terminal of human TCF19. Synthetic peptide located within the following region: VSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM |
Goat Polyclonal Antibody against TCF19
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RSTAKAPSDTPAHE, from the C Terminus of the protein sequence according to NP_009040. |
Rabbit polyclonal antibody to TCF19 (transcription factor 19 (SC1))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 296 and 309 of TCF19 (Uniprot ID#Q9Y242) |
TCF19 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TCF19 |
TCF19 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human TCF19 (NP_009040.2). |
Modifications | Unmodified |