Antibodies

View as table Download

TCF19 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TCF19

Rabbit Polyclonal Anti-TCF19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF19 Antibody: synthetic peptide directed towards the N terminal of human TCF19. Synthetic peptide located within the following region: VSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM

Goat Polyclonal Antibody against TCF19

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSTAKAPSDTPAHE, from the C Terminus of the protein sequence according to NP_009040.

Rabbit polyclonal antibody to TCF19 (transcription factor 19 (SC1))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 296 and 309 of TCF19 (Uniprot ID#Q9Y242)

TCF19 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TCF19

TCF19 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human TCF19 (NP_009040.2).
Modifications Unmodified