Antibodies

View as table Download

Rabbit polyclonal MORC3 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MORC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 634-663 amino acids from the Central region of human MORC3.

MORC3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human MORC3

Morc3 Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Morc3 whole rabbit serum was prepared by repeated immunizations with a human Morc3 recombinant protein.

Rabbit Polyclonal Anti-MORC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MORC3 antibody: synthetic peptide directed towards the N terminal of human MORC3. Synthetic peptide located within the following region: KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT