KLF8 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human KLF8 (NP_009181.2). |
KLF8 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human KLF8 (NP_009181.2). |
Rabbit Polyclonal anti-KLF8 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLF8 antibody: synthetic peptide directed towards the N terminal of human KLF8. Synthetic peptide located within the following region: LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTV |
Rabbit Polyclonal Anti-KLF8 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-KLF8 Antibody: synthetic peptide directed towards the middle region of human KLF8. Synthetic peptide located within the following region: LEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGGESLDLKRRRIHQ |
Goat Polyclonal Antibody against KLF8
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence VDMDKLINNLEVQ-C, from the N Terminus of the protein sequence according to NP_009181.2. |
Rabbit Polyclonal Anti-KLF8 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLF8 antibody: synthetic peptide directed towards the N terminal of human KLF8. Synthetic peptide located within the following region: LLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVS |