Antibodies

Jump to Filters
View as table Download
Enkephalin (PENK) Goat Polyclonal Antibody
TA303308

USD 520.00

5 Days

Goat Polyclonal Antibody against PENK

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSHHQDGSDNEE, from the internal region of the protein sequence according to NP_006202.1.
TA303308 is a possible alternative to AM01180PU-N.
Enkephalin (PENK) Rabbit Polyclonal Antibody
TA345157

USD 539.00

5 Days

Rabbit Polyclonal Anti-PENK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG