ANGPTL3 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ANGPTL3 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANGPTL3 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ANGPTL3 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
ANGPTL3 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Rabbit Polyclonal Anti-ANGPTL3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ANGPTL3 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human ANGPTL3. |
ANGPTL3 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ANGPTL3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of Human Angiopoietin-related protein 3 |
Rabbit Polyclonal Anti-ANGPTL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANGPTL3 antibody: synthetic peptide directed towards the N terminal of human ANGPTL3. Synthetic peptide located within the following region: VKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEI |
Rabbit Polyclonal Anti-ANGPTL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANGPTL3 antibody: synthetic peptide directed towards the N terminal of human ANGPTL3. Synthetic peptide located within the following region: IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL |
Anti-ANGPTL3 Reference Antibody (evinacumab)
Applications | Animal Model, ELISA, FACS, FN, Kinetics |
Reactivities | Human, Mouse, Cynomolgus |
Conjugation | Unconjugated |
ANGPTL3 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 82-114 amino acids from the N-terminal region of human ANGPTL3 |
ANGPTL3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ANGPTL3 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL3 |
ANGPTL3 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANGPTL3 |
Anti-ANGPTL3 antibody(DM205), Rabbit mAb
Applications | ELISA, FC |
Reactivities | Human |
Conjugation | Unconjugated |