Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TRIM26 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIM26 Antibody: synthetic peptide directed towards the middle region of human TRIM26. Synthetic peptide located within the following region: KKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRG |
Rabbit Polyclonal Anti-TRIM26 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIM26 Antibody: synthetic peptide directed towards the N terminal of human TRIM26. Synthetic peptide located within the following region: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLR |
TRIM26 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRI26 |
TRIM26 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human TRIM26 (NP_001229712.1). |
| Modifications | Unmodified |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- TRIM26
Reactivities
- Human