Rabbit polyclonal antibody to SSRP1 (structure specific recognition protein 1)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 75 and 338 of SSRP1 (Uniprot ID#Q08945) |
SSRP1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 489-518 amino acids from the C-terminal region of Human SSRP1. |
Mouse Monoclonal anti-SSRP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-SSRP1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSRP1 antibody: synthetic peptide directed towards the middle region of human SSRP1. Synthetic peptide located within the following region: SSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMS |
Rabbit Polyclonal Anti-SSRP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSRP1 antibody: synthetic peptide directed towards the middle region of human SSRP1. Synthetic peptide located within the following region: MKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESF |
Rabbit Polyclonal Anti-SSRP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSRP1 antibody: synthetic peptide directed towards the N terminal of human SSRP1. Synthetic peptide located within the following region: MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTE |
Rabbit Polyclonal SSRP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSRP1 antibody: human SSRP1 (Structure-specific recognition protein 1), the GST tagged N-terminal part of the protein. |
SSRP1 rabbit polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full-length recombinant SSRP1 protein tagged with histidine. |
SSRP1 rabbit polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein consisting of amino acids 1-242 of the human SSRP1 protein. |
Germany
Japan
United Kingdom
China
