Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-EMR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | EMR1 / F4/80 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human EMR1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Marmoset (89%); Gibbon (83%). |
Rabbit polyclonal anti-EMR1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EMR1. |
ADGRE1 (N-term, extracell. dom.) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 19 amino acid peptide from N-terminal extracellular domain of human EMR1 |
F4/80 Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of Mouse F4/80. |
ADGRE1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EMR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EMR1 antibody is: synthetic peptide directed towards the C-terminal region of Human EMR1. Synthetic peptide located within the following region: GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG |
Anti-ADGRE1 antibody(DMC481), IgG1 Chimeric mAb
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ADGRE1
Reactivities
- Human