UBE3B mouse monoclonal antibody,clone OTI3F10
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UBE3B mouse monoclonal antibody,clone OTI3F10
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE3B mouse monoclonal antibody,clone OTI3F10
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
UBE3B mouse monoclonal antibody,clone OTI3F10, Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
UBE3B mouse monoclonal antibody,clone OTI3F10, HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE3B mouse monoclonal antibody,clone OTI4E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE3B mouse monoclonal antibody,clone OTI4E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
UBE3B mouse monoclonal antibody,clone OTI4E4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
UBE3B mouse monoclonal antibody,clone OTI4E4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE3B mouse monoclonal antibody,clone OTI3F10
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UBE3B mouse monoclonal antibody,clone OTI4E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-UBE3B antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UBE3B. |
Rabbit Polyclonal Anti-UBE3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE3B antibody: synthetic peptide directed towards the middle region of human UBE3B. Synthetic peptide located within the following region: VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE |