SPTAN1 mouse monoclonal antibody,clone OTI9C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SPTAN1 mouse monoclonal antibody,clone OTI9C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SPTAN1 mouse monoclonal antibody,clone OTI9C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
SPTAN1 mouse monoclonal antibody,clone OTI9C10, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
SPTAN1 mouse monoclonal antibody,clone OTI9C10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SPTAN1 mouse monoclonal antibody,clone OTI9C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region
Applications | IHC, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ |
Rabbit Polyclonal Anti-SPTAN1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SPTAN1 |
Alpha Fodrin (SPTAN1) (676-1043) mouse monoclonal antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal SPTA2 (Cleaved-Asp1185) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | the antiserum was produced against synthesized peptide derived from human SPTA2. |